| Basic Information | |
|---|---|
| Taxon OID | 3300009073 Open in IMG/M |
| Scaffold ID | Ga0114957_1059090 Open in IMG/M |
| Source Dataset Name | Marine algal microbial communities from Bantry Bay, Ireland - BantryBay_4 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1632 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bantry Bay, Ireland | |||||||
| Coordinates | Lat. (o) | 51.64 | Long. (o) | -9.71 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073006 | Metagenome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114957_10590902 | F073006 | N/A | MHVQVLEADDVSEVLDFIGEPRAIFQVEGNPGFAGTVKNRVIVFDVLFRVCGEDDDVV* |
| ⦗Top⦘ |