Scaffold Ga0105152_10111571

Overview

Basic Information

• Taxon OID: 3300009039
• Scaffold ID: Ga0105152_10111571
• Source Dataset Name: Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1113
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. PtaB.Bin001 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Russia: Lake Baikal
• Coordinates
  • Lat. (^o): 53.7598
  • Long. (^o): 107.9791
  • Depth (m): 0 to .05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035129	Metagenome / Metatranscriptome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105152_101115712	F035129	N/A	MHSTAFAADISGSIAFEFQENGNFTGVIGKAYVSEKAVEVVTFAEQNGTVVPFAFIYTILEKETKTNGVYNIKCRNQLGVTSVGTIDLRDRANPKITLKSDKGITLTNISDSGRKMKKEFLPKVDLGK*