Basic Information | |
---|---|
Taxon OID | 3300009034 Open in IMG/M |
Scaffold ID | Ga0115863_1231527 Open in IMG/M |
Source Dataset Name | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Macrogen |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2207 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal → Subsurface Anoxic Archaea In Intertidal Mud Flat Sediment |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Garolim Bay, Chungcheongnam-do, Korea | |||||||
Coordinates | Lat. (o) | 36.88 | Long. (o) | 126.38 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F075043 | Metagenome / Metatranscriptome | 119 | Y |
F092306 | Metagenome / Metatranscriptome | 107 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115863_12315271 | F075043 | N/A | MKEIRKNQLADMKAPPSRIQECEDKFTYLDGAMSGIKESHVNEQLREVMTSADFTYAIMEFVQRQMVPGYQRMEFPFEPLVAMDTVPNFLPVTRYQKRAGLDDLEYVGEKGQARPGSVVDATKRQYQVYRWEKQFDFSYEALVNDDLGYFQDQADLMGQAARRTLEKFVSRMYTNAVSIAALTVLGALYSQNGRLTSARISEARMGFGQRVDARNEPVEAELAFIVYHRGLEDTVRTIQASQLVPELATNAANVVRTGWTGIKDPHMAGTAPNLPWWGFTNHAANNIQPFKLARLSGRPAPLILRKDVDSVIVSSLLGGGRPAEPILGDFETGNIILKVSDVFGTYI |
Ga0115863_12315272 | F092306 | AGGAGG | MAMPDTFQEGTDWQQSSEPKTIVDVQESDCWPVDDNSGSGTKDELAPGLHPVIAIGGRTAADGRPLNVTGVGVSYAGTGSGTSTDRVEVNIADGVIVWQYVANVLTYANNIPDTFEQAPVVGQPVYVDDSNDLSEGVTLSMSPLNDTDVKNPQAGYLWYCQDEIADGHTGGSRSTSTFDGTLANELVEQEYCVLLTNNSRDLT* |
⦗Top⦘ |