Scaffold Ga0115863_1206330

Overview

Basic Information

• Taxon OID: 3300009034
• Scaffold ID: Ga0115863_1206330
• Source Dataset Name: Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Macrogen
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2364
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal → Subsurface Anoxic Archaea In Intertidal Mud Flat Sediment

Source Dataset Sampling Location

• Location Name: Garolim Bay, Chungcheongnam-do, Korea
• Coordinates
  • Lat. (^o): 36.88
  • Long. (^o): 126.38

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019908	Metagenome	227	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115863_12063304	F019908	AGGA	MKPKYRVHVWDADADNTETVFEAPAKPTLDQLYKLIGCSTVERVSGYDKDISNRTFDIWIDEEGKFNNPNKNLRATNAWFRWMHRTGHVNIPGDYISGKAVCYKKI*