| Basic Information | |
|---|---|
| Taxon OID | 3300009034 Open in IMG/M |
| Scaffold ID | Ga0115863_1148607 Open in IMG/M |
| Source Dataset Name | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Macrogen |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2868 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal → Subsurface Anoxic Archaea In Intertidal Mud Flat Sediment |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Garolim Bay, Chungcheongnam-do, Korea | |||||||
| Coordinates | Lat. (o) | 36.88 | Long. (o) | 126.38 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008412 | Metagenome / Metatranscriptome | 333 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115863_11486074 | F008412 | AGAAGG | MSKIWLYVRTRKKLKGSYIASVPLKKLIKLSGYRKKRWEFKDGWLILEAF* |
| ⦗Top⦘ |