Scaffold Ga0115863_1045546

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115863_1045546

Scaffold Ga0115863_1045546

Overview

Basic Information
Taxon OID	3300009034 Open in IMG/M
Scaffold ID	Ga0115863_1045546 Open in IMG/M
Source Dataset Name	Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Macrogen
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5687
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal → Subsurface Anoxic Archaea In Intertidal Mud Flat Sediment

Source Dataset Sampling Location
Location Name	Garolim Bay, Chungcheongnam-do, Korea
Coordinates	Lat. (^o)	36.88	Long. (^o)	126.38	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008521	Metagenome / Metatranscriptome	332	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115863_104554610	F008521	AGCAGG	MNTKNQKASRLSKKNQSASFLIWIVSGLYLLTMVWFRLTKMGNYDANETQQWLVPAVVAFTVCYGILMSLLWPDENVSPERFVR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.