Scaffold Ga0115863_1022154

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115863_1022154

Scaffold Ga0115863_1022154

Overview

Basic Information
Taxon OID	3300009034 Open in IMG/M
Scaffold ID	Ga0115863_1022154 Open in IMG/M
Source Dataset Name	Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Macrogen
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8654
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal → Subsurface Anoxic Archaea In Intertidal Mud Flat Sediment

Source Dataset Sampling Location
Location Name	Garolim Bay, Chungcheongnam-do, Korea
Coordinates	Lat. (^o)	36.88	Long. (^o)	126.38	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052014	Metagenome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115863_10221543	F052014	AGGAGG	MERTPTTLYLWISRLAGFAGLACIVIAVVTAVTDDVLYALPRTYVQIAIAAFLFAIWGVLYELRDQGIRTR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.