Scaffold Ga0102956_1090375

Overview

Basic Information

• Taxon OID: 3300009033
• Scaffold ID: Ga0102956_1090375
• Source Dataset Name: Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 973
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location

• Location Name: South San Francisco, USA
• Coordinates
  • Lat. (^o): 37.4971
  • Long. (^o): -122.129
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081352	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102956_10903751	F081352	N/A	MFLADVSLMIQLIRKISTITLVCLLVLNLTAGAAVVVEHCPPLLGSSSPMDIDHCDGMLNFAFPMQGCCGECNDIFCDLIKNPLQDANAVNASPFQGSCYPFFLGTVDPIAESGTWVASSAPRYLFFAALAWSQIPLYIENLALII*