| Basic Information | |
|---|---|
| Taxon OID | 3300009025 Open in IMG/M |
| Scaffold ID | Ga0103707_10096776 Open in IMG/M |
| Source Dataset Name | Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Woods Hole Oceanographic Institution |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 621 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Eukaryotic Communities From Seawater Of The North Pacific Subtropical Gyre |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pacific Subtropical Gyre | |||||||
| Coordinates | Lat. (o) | 22.75 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006254 | Metatranscriptome | 377 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103707_100967761 | F006254 | N/A | LQIGNISSKKASNAAASDRIESLSAYIDDVKSGRVEFTSERKDLEAEIAKLNSEIEEATAMRKKDNEDFLAAKDEMEKAVAALEEAVEILGTTTEDMKTGVLMSTRFDLRRAVSLGSQMLSESDTKLLEHALDGDVDPDWKKLNRKAVFKMKYKARSGK |
| ⦗Top⦘ |