NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103707_10053760

Scaffold Ga0103707_10053760


Overview

Basic Information
Taxon OID3300009025 Open in IMG/M
Scaffold IDGa0103707_10053760 Open in IMG/M
Source Dataset NameEukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterWoods Hole Oceanographic Institution
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)736
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Eukaryotic Communities From Seawater Of The North Pacific Subtropical Gyre

Source Dataset Sampling Location
Location NameNorth Pacific Subtropical Gyre
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007099Metatranscriptome357N

Sequences

Protein IDFamilyRBSSequence
Ga0103707_100537601F007099N/AGQIIMNSSMGTFMGLLVALALLSSAHAFDCKRYTVKQIDISGNQTGNMSEIFRTTKDTQRCSAVYKLDNTTCSSMQLTCGRWYLPNKDPVQCRRGDKFLIKVDDSKPRVFCEHEKPTSYYPAYSFQRMKVWFSAAVDSKFPNSGATCKIKCAEVI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.