Scaffold Ga0103928_10380853

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103928_10380853

Scaffold Ga0103928_10380853

Overview

Basic Information
Taxon OID	3300009023 Open in IMG/M
Scaffold ID	Ga0103928_10380853 Open in IMG/M
Source Dataset Name	Planktonic microbial communities from coastal waters of California, USA - Canon-29
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Hawaii
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	545
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102449	Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103928_103808531	F102449	N/A	IKSMIETLLSDAQADASHKAYCDKELGESATKKAEKTALIDKLSAQIDSMTAKSAQLKEQVALLQKELAELAKSQSEMNKIRAEEKATYKTNKAEMEEGISGIKAALKLLRDYYAKDDKSHDAADGAGSGIVGMLEVVESDFTKGLAEMTVTEQTSQGEYDKETRENEITKATKDQSVKY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.