| Basic Information | |
|---|---|
| Taxon OID | 3300009023 Open in IMG/M |
| Scaffold ID | Ga0103928_10300133 Open in IMG/M |
| Source Dataset Name | Planktonic microbial communities from coastal waters of California, USA - Canon-29 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hawaii |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 600 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044282 | Metatranscriptome | 154 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103928_103001331 | F044282 | N/A | MTWPELLEHMDNLSEWGHGELKAWTAQASQLQKNAHAVGVRTQNMENEEACLAEDLKHRMQVQNKLAGVCVDMCKEVGAYPKCTCPDFVQPDSTPGVMTWPELLEHMDNLSEWG |
| ⦗Top⦘ |