Basic Information | |
---|---|
Taxon OID | 3300009023 Open in IMG/M |
Scaffold ID | Ga0103928_10238129 Open in IMG/M |
Source Dataset Name | Planktonic microbial communities from coastal waters of California, USA - Canon-29 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Hawaii |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 658 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031743 | Metatranscriptome | 181 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103928_102381291 | F031743 | N/A | MTAVEHSAQQDVLQYVLPVFAVAMAFAAPFITFKALGRGPVMGELKAAAGRRLSLISLAITLLSPAFLISNYTQTTVFQYAVYSMLLSQATLVADRLAKRRTLPPLLVWHSINLLNLVGGTFSSLLQIYSTNSAGLIMTIYSIAPNGDCPDDALAVNYCSDGWVAVQLLAGFVYLVLHILAFFTVLMRVTHLYGGEDEKPMY |
⦗Top⦘ |