Scaffold Ga0066710_100005324

Overview

Basic Information

• Taxon OID: 3300009012
• Scaffold ID: Ga0066710_100005324
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 11692
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: USA: California: Angelo Coastal Reserve
• Coordinates
  • Lat. (^o): 39.7392
  • Long. (^o): -123.6308
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011779	Metagenome	287	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066710_1000053243	F011779	GGAGG	MSSALRGIWDNTYGLLVDDGQLAVGAILALAITWLVAASGTDALRENAGWLLLVLVVVLVVANLYRAGRNARRRVS