Scaffold Ga0103710_10089921

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103710_10089921

Scaffold Ga0103710_10089921

Overview

Basic Information
Taxon OID	3300009006 Open in IMG/M
Scaffold ID	Ga0103710_10089921 Open in IMG/M
Source Dataset Name	Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Woods Hole Oceanographic Institution
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	751
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Eukaryotic Communities From Seawater Of The North Pacific Subtropical Gyre

Source Dataset Sampling Location
Location Name	North Pacific Subtropical Gyre
Coordinates	Lat. (^o)	22.75	Long. (^o)	-158.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038074	Metatranscriptome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103710_100899212	F038074	N/A	MDSSKDNLNSCDSQVGISKPASSASKATIEEYLKVDEPIQATPTVQVNGKNVKTSYSAIRSAICEADPSLSGCTSPVPTDADTEIQQFCEKPSRVVV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.