Basic Information | |
---|---|
Taxon OID | 3300009001 Open in IMG/M |
Scaffold ID | Ga0102963_1178394 Open in IMG/M |
Source Dataset Name | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 851 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration. |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South San Francisco, USA | |||||||
Coordinates | Lat. (o) | 37.4973 | Long. (o) | -122.1295 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004209 | Metagenome / Metatranscriptome | 448 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0102963_11783941 | F004209 | N/A | NMWVGIMLVCFDPMALSCKIIAKPEPFYTEQACLEEAGQVAETIRQGGAYATPHCHKVEGDSA* |
⦗Top⦘ |