| Basic Information | |
|---|---|
| Taxon OID | 3300009001 Open in IMG/M |
| Scaffold ID | Ga0102963_1139401 Open in IMG/M |
| Source Dataset Name | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 980 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South San Francisco, USA | |||||||
| Coordinates | Lat. (o) | 37.4973 | Long. (o) | -122.1295 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030452 | Metagenome / Metatranscriptome | 185 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0102963_11394012 | F030452 | AGGAG | MADVIKVTSGSQAVLSLGNTAPLAVPGAANTMVVPLMQDITVNATPGTVRYSTLDNTASSAFTTTNENSISLNMLVDETTFFGGGDALNSVANVGLLSTSIAKTEIFFSVAFEGTDSTDYYVSGKGFIGGLAPSASMDQAVWISPMEIIVNGELTKTQV* |
| ⦗Top⦘ |