| Basic Information | |
|---|---|
| Taxon OID | 3300008998 Open in IMG/M |
| Scaffold ID | Ga0103502_10102461 Open in IMG/M |
| Source Dataset Name | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1019 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001556 | Metatranscriptome | 671 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103502_101024611 | F001556 | N/A | MTRILLLSMVASGMAMSTRQEIQMDMEKFNNDAMCWGVENMMYYRLAQYQAMEECSKYGQFSTLPAPANNPFTTLPGDAKNPWMNVPQPVDSRRNPLAKLFNRNSNSNSDKWANLWSDFLNGRSKRQAEEGGLLEIDEAAELEKFLADYDEFKEDIGSMIGNLTCVMTKLDMLDSALQVNLKLWTTDVWQQLDLKKTLAGEDPEWRQKMIGGYTDCYQVASNWPQQSLDRNPITKVFGRHMIFFKCAMKQEKKMCGMAQMYSWLKTLYGDSDDFNWSQFGLPQDKYDRAALTIMVQTQAASKEERFINDFFVNDEL* |
| ⦗Top⦘ |