Scaffold Ga0102831_1329124

Overview

Basic Information

• Taxon OID: 3300008996
• Scaffold ID: Ga0102831_1329124
• Source Dataset Name: Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 505
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: Columbia River Estuary, USA
• Coordinates
  • Lat. (^o): 46.2
  • Long. (^o): -123.94

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062786	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102831_13291242	F062786	N/A	FIEWLRGFAEGVHHYNITPKQWDHLKEKLQSVGSKSTANYSTGNWVMNNTWE*