Scaffold Ga0116025_10013643

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116025_10013643

Scaffold Ga0116025_10013643

Overview

Basic Information
Taxon OID	3300008988 Open in IMG/M
Scaffold ID	Ga0116025_10013643 Open in IMG/M
Source Dataset Name	Combined Assembly of De NOVO T65 T0 (live) Oil Sands Gp0125710, Gp0125712, Gp0125662
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shell Corporation
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1293
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada

Source Dataset Sampling Location
Location Name	Alberta, Canada
Coordinates	Lat. (^o)	57.02	Long. (^o)	-111.65	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059711	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116025_100136433	F059711	AGGAG	MRERTLHTSINLLLDPDTYQRIKMIATLQKIPMSKFIREGINLRLAQYDKENNSVIGGKDRGRTDNQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.