Scaffold Ga0102930_1156673

Overview

Basic Information

• Taxon OID: 3300008963
• Scaffold ID: Ga0102930_1156673
• Source Dataset Name: Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_H2O_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 545
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location

• Location Name: South San Francisco, USA
• Coordinates
  • Lat. (^o): 37.4968
  • Long. (^o): -122.1333
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008719	Metagenome / Metatranscriptome	329	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102930_11566732	F008719	N/A	GATFAWNNIPGANNLGVSVESFSDDALKRQQVAEHIQVKMAYDMKVVGSDLGGFINSAIS