Scaffold Ga0104242_1050850

Overview

Basic Information

• Taxon OID: 3300008962
• Scaffold ID: Ga0104242_1050850
• Source Dataset Name: Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 698
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location

• Location Name: Lake Lanier in Georgia, USA
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011394	Metagenome / Metatranscriptome	291	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104242_10508502	F011394	AGGA	MFIDKNKDHFKYGINEWTGEPNKPVFYTKEMAKKVRELKSPASNLEMDIVKYPEFLAIRLYENNFSQYDGSMRVRVIEYIEMVKNILESYGVRVELEGKPGGKNHG*