Basic Information | |
---|---|
Taxon OID | 3300008962 Open in IMG/M |
Scaffold ID | Ga0104242_1038425 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Georgia Institute of Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 815 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Lanier in Georgia, USA | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023346 | Metagenome / Metatranscriptome | 210 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0104242_10384251 | F023346 | N/A | MNNTISKNIIITYAKALRTIQKDQIDPYVELIEKELIKVYPELEDRDDNALNWAYDILNATSNAEVVETLTRLEKIIIDERKEKWVCGYCGKNTYNDDVDYLFGTNHIGCALEEDIKNREHSDPDYILDARLKKISDIERKLDTYESELNKLHAELVRLRSDYELVQRVAY |
⦗Top⦘ |