NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104259_1032252

Scaffold Ga0104259_1032252


Overview

Basic Information
Taxon OID3300008958 Open in IMG/M
Scaffold IDGa0104259_1032252 Open in IMG/M
Source Dataset NameMarine microbial communities from eastern North Pacific Ocean - P1 particle-associated
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Georgia
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)550
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities From Seawater In Eastern North Pacific Ocean

Source Dataset Sampling Location
Location Nameeastern North Pacific Ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000691Metatranscriptome933Y

Sequences

Protein IDFamilyRBSSequence
Ga0104259_10322521F000691N/ASQEFLQAEGEPMEVVEGVKQVPVVGKEFDTNGGVPTAMQCVVSLTIQFMLVYTSLAICRMAADGFGLKYDNLPIQKILQTATLTVAFAPMLAILFLAFRMRVNQLTRNRGDPAEWAQVCMYFCTYAVLLMTLCVCVIPLFTGEVMGVDTKTGQIPEDAEPFKNQACAIGFTVLKYIILLMLY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.