Scaffold Ga0104259_1024408

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0104259_1024408

Scaffold Ga0104259_1024408

Overview

Basic Information
Taxon OID	3300008958 Open in IMG/M
Scaffold ID	Ga0104259_1024408 Open in IMG/M
Source Dataset Name	Marine microbial communities from eastern North Pacific Ocean - P1 particle-associated
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Georgia
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	615
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities From Seawater In Eastern North Pacific Ocean

Source Dataset Sampling Location
Location Name	eastern North Pacific Ocean
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082093	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104259_10244081	F082093	N/A	MASAAEGTNGAELNCSMNGYTEMVEQIMSLALVAITLVVSTFGAILPSDLSRSLKLMYRFIKSSANWMGFLVAAVYYIGLDLGYGELLCTASQYGFIVIYYLNFVIQFGNV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.