Scaffold Ga0104259_1008933

Overview

Basic Information

• Taxon OID: 3300008958
• Scaffold ID: Ga0104259_1008933
• Source Dataset Name: Marine microbial communities from eastern North Pacific Ocean - P1 particle-associated
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Georgia
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 905
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities From Seawater In Eastern North Pacific Ocean

Source Dataset Sampling Location

• Location Name: eastern North Pacific Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038529	Metatranscriptome	165	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0104259_10089331	F038529	N/A	MSLFKFAIAIVAGSSVIAQADIISDLTSSSFDEKRALEIKAGQFWDGVLKASEEMNMETHVAVYDEAEAVLASLPAENDYVRKALQESLTRLKRADETVLLQSVRTSQTASDSLASPVTGDFFSFMKGGQNFFAQAIRGFVDGGRYSEKLVRHVGERQGEILPVLQETNEITGNVLKDCRLASQRSFDVLKYDIYNKDVPKTPENAKALAYRMVEAVGETRHKFMRFVTEAADSIARDTAEKDEPAATTVIKSSLRAMDFAMDFAESADGSGDLQPFGSIVS