Scaffold Ga0104239_1017555

Overview

Basic Information

• Taxon OID: 3300008957
• Scaffold ID: Ga0104239_1017555
• Source Dataset Name: Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT2
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 634
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location

• Location Name: Lake Lanier in Georgia, USA
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056548	Metagenome / Metatranscriptome	137	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0104239_10175552	F056548	GGAG	MRHRLDHPEDVEGCFGCKVLGLQLSPGDATSSKSMSNKKWDAELNAYRSARDQGIQPEGTSMAAIQRAVKASEVMGKAYDANTMTSANYINKQSATTLKEAGAI*