Scaffold Ga0104241_1008085

Overview

Basic Information

• Taxon OID: 3300008953
• Scaffold ID: Ga0104241_1008085
• Source Dataset Name: Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 729
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location

• Location Name: Lake Lanier in Georgia, USA
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008236	Metagenome / Metatranscriptome	336	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104241_10080852	F008236	AGG	MWFYTHIYDSRLVSLEKYMNVYASVHDDNDMGEALAQGFKLFAWCDSDMKIAPKRPKSKAKAEAWRKALPKLVVLNATKFVVCPEIRRGRSEITCTGTKDSISCDLCVRGLANVLFPAH*