Scaffold Ga0116013_1029142

Overview

Basic Information

• Taxon OID: 3300008947
• Scaffold ID: Ga0116013_1029142
• Source Dataset Name: Combined Assembly of De NOVO T10 (live) Tyne Sediment Benzoate Gp0125103, Gp0125104, Gp0125105
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Shell Corporation
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 921
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Source Dataset Sampling Location

• Location Name: UK (Newcastle upon Tyne)
• Coordinates
  • Lat. (^o): 54.971158
  • Long. (^o): -1.703654

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024002	Metagenome / Metatranscriptome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116013_10291421	F024002	GGA	MEVLDGQEIVNASLDPFLFPQGLALGAVPVSAGVIGYLHMPAGVALILMAAKDSSSAYFYGTHDPQMIAGQFMGLFIRRAVLTENIRHFQAGRGLHSLAGLRNLLGGFIEGACDLGQVQTTDMEIDGGRCRGSVTK