Scaffold Ga0103705_102052

Overview

Basic Information

• Taxon OID: 3300008927
• Scaffold ID: Ga0103705_102052
• Source Dataset Name: Microbial communities from freshwater in the western basin of Lake Erie, USA - 973-3
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Tennessee
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 783
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: western basin of Lake Erie, USA
• Coordinates
  • Lat. (^o): 41.79
  • Long. (^o): -83.33

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060948	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103705_1020521	F060948	N/A	FAFLIIQLTVFLGLVLCCTHLSDVTLTIAKNAFRTFFLFIGKVEWLLFTDGMLNSDTVIRLAYAHYVVAFYLFFLGLSHGIDMHYD*