Scaffold Ga0103486_1009281

Overview

Basic Information

• Taxon OID: 3300008921
• Scaffold ID: Ga0103486_1009281
• Source Dataset Name: Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NB1
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Sodertorn University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 638
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water → Microbial Communities Of Nutrient Treated Water From Blanes Bay, Barcelona, Spain

Source Dataset Sampling Location

• Location Name: Barcelona, Spain
• Coordinates
  • Lat. (^o): 41.666
  • Long. (^o): 2.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011139	Metagenome / Metatranscriptome	294	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103486_10092812	F011139	AGG	MGLYFGLLLLLPIIYNLYNTFHKYVATIPMQNSILQTSVFIIFMLSLYCVASMLPCGRYYYEPEGGYVGNP*