Scaffold Ga0103891_10022

Overview

Basic Information

• Taxon OID: 3300008843
• Scaffold ID: Ga0103891_10022
• Source Dataset Name: Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2057
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Massachusetts Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 697
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre

Source Dataset Sampling Location

• Location Name: North Pacific Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032308	Metagenome / Metatranscriptome	180	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103891_100223	F032308	N/A	MFYSGDVSIKEGATLTVCVPIGDINNSDDLNFEINLVDVTRVEPISSPILS*