| Basic Information | |
|---|---|
| Taxon OID | 3300008832 Open in IMG/M |
| Scaffold ID | Ga0103951_10678929 Open in IMG/M |
| Source Dataset Name | Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 562 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009938 | Metagenome / Metatranscriptome | 311 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103951_106789291 | F009938 | GGA | MENLLEENSLAFQSNQSCCTSTSEKKSVTKSSDSIKEESEMEMDIDKINGENKIIEPKTHVVSKAFMSVSCQGTIEKVEIKIQFHGHRFKAENLDVQVVNKDVLIVKAKDDEEKFERKLKIPSNTLVEKISSKFDVKEEDVQTLLINIPKDVKFFQVPIVM |
| ⦗Top⦘ |