| Basic Information | |
|---|---|
| Taxon OID | 3300008795 Open in IMG/M |
| Scaffold ID | Ga0103701_102439 Open in IMG/M |
| Source Dataset Name | Microbial communities from freshwater in the western basin of Lake Erie, USA - 882-2 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Tennessee |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 569 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | western basin of Lake Erie, USA | |||||||
| Coordinates | Lat. (o) | 41.76 | Long. (o) | -83.31 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027191 | Metagenome / Metatranscriptome | 195 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103701_1024391 | F027191 | AGAAG | MLKRHKAVRFLISPKIKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK* |
| ⦗Top⦘ |