NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103696_1023231

Scaffold Ga0103696_1023231


Overview

Basic Information
Taxon OID3300008791 Open in IMG/M
Scaffold IDGa0103696_1023231 Open in IMG/M
Source Dataset NameMicrobial communities from seawater in eastern North Pacific Ocean - P1 free-living McLane
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Georgia
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)672
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities From Seawater In Eastern North Pacific Ocean

Source Dataset Sampling Location
Location Nameeastern North Pacific Ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043416Metagenome / Metatranscriptome156Y
F063590Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0103696_10232312F043416AGGAGMFAKLRDWLDICKVHWKEIFAMSFMLHFIMDLFIIGPLFFLLGYFFGISVEH*
Ga0103696_10232313F063590GGAGMIEILQEVTDWGDQQINNGIYHVNGAGQLVQYNDKVSKTPMKQFSKSRRKFTKIGERE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.