Scaffold Ga0103689_1002835

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103689_1002835

Scaffold Ga0103689_1002835

Overview

Basic Information
Taxon OID	3300008789 Open in IMG/M
Scaffold ID	Ga0103689_1002835 Open in IMG/M
Source Dataset Name	Microbial communities of hydrothermal vent plumes from the Guaymas Basin in the Gulf of California - Background GD7i
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	513
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent In Guaymas Basin In The Gulf Of California → Microbial Communities Of Hydrothermal Vent Plumes From The Guaymas Basin In The Gulf Of California

Source Dataset Sampling Location
Location Name	Guaymas Basin in the Gulf of California
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098669	Metagenome / Metatranscriptome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103689_10028351	F098669	GAG	METATRGRKQKWRLKEAEGLGRKRRIEEAERRELHESDQGLDPGHGLNPGRKVRRIDQAMEGSPEIVRFRP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.