| Basic Information | |
|---|---|
| Taxon OID | 3300008785 Open in IMG/M |
| Scaffold ID | Ga0103638_1003329 Open in IMG/M |
| Source Dataset Name | Microbial communities from wetland soil in Czech Republic - R1_cDNA |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Friedrich Schiller University of Jena |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 570 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil → Microbial Communities From Wetland Soil In Czech Republic |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Czech Republic | |||||||
| Coordinates | Lat. (o) | 50.14667 | Long. (o) | 12.45083 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001296 | Metagenome / Metatranscriptome | 728 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103638_10033291 | F001296 | GGAG | MEAAERRQPLRGSKKPLRATGSGQEAASGEPGSIDPGVGENGPWGAERRIVQRFCPQCSMPCMPVESQAGNQV |
| ⦗Top⦘ |