Scaffold Ga0103638_1002996

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103638_1002996

Scaffold Ga0103638_1002996

Overview

Basic Information
Taxon OID	3300008785 Open in IMG/M
Scaffold ID	Ga0103638_1002996 Open in IMG/M
Source Dataset Name	Microbial communities from wetland soil in Czech Republic - R1_cDNA
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Friedrich Schiller University of Jena
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	583
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil → Microbial Communities From Wetland Soil In Czech Republic

Source Dataset Sampling Location
Location Name	Czech Republic
Coordinates	Lat. (^o)	50.14667	Long. (^o)	12.45083	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098815	Metagenome / Metatranscriptome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103638_10029961	F098815	N/A	MRGQSLACSVAETLPSCSPLRLLSRLGSVRQSPLALLPARSLRLGTAFRSPATTVLFREPPWRGQRSWPIPSTVIPNSFSSPFGLELPPSAPFFTSPGAFRAQNPLPSSKLGTLKRPSNFRSPPGLSSLGIVALGQRLSLRSLPLCPARSSFAPR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.