Scaffold Ga0115657_1228410

Overview

Basic Information

• Taxon OID: 3300008735
• Scaffold ID: Ga0115657_1228410
• Source Dataset Name: Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Genomics Facility
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 939
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location

• Location Name: Cariaco Basin, Venezuela
• Coordinates
  • Lat. (^o): 10.5
  • Long. (^o): -64.66
  • Depth (m): 237

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084725	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115657_12284102	F084725	AGG	MDTKELQENAERYCELLIVYDNMLQVLEKVTQKITETKKELVYLEVVLQKNGAIIKDVEIEQ*