NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115615_10488

Scaffold Ga0115615_10488


Overview

Basic Information
Taxon OID3300008711 Open in IMG/M
Scaffold IDGa0115615_10488 Open in IMG/M
Source Dataset NameHuman posterior fornix microbial communities from NIH, USA - visit 1, subject 675950834 reassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)643
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Reproductive System → Vagina → Posterior Fornix → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameNational Institutes of Health, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F057001Metagenome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0115615_104881F057001GAGGMPIQVPRARANLMTGKDLNKVQNEVKKASEKTLTGAVKAWCQLFKSGKEINEILKDNDIKVDKTVVPALIALAKDKEIVIQLCKEILPRVDETFCAYKEIERVYLDKQDQDKNIKLSEDKVTEISITGKAHKRFGYNEPVEYEGGVYYEMFNGSDKRIVKCAVPIKR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.