NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115605_102401

Scaffold Ga0115605_102401


Overview

Basic Information
Taxon OID3300008707 Open in IMG/M
Scaffold IDGa0115605_102401 Open in IMG/M
Source Dataset NameHuman palatine tonsils microbial communities from NIH, USA - visit 1, subject 763577454 reassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1855
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Myoviridae sp. ctYA416(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Palatine Tonsils → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameNational Institutes of Health, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099453Metagenome103N

Sequences

Protein IDFamilyRBSSequence
Ga0115605_1024012F099453N/AMLRRKDMNRFDVIELAQQTLTFVYDTFNGKVNTLDPYTRLNFVAGYLDTKTNIARTTPYGCIYISLEAFADTVELHGFIDTDQIRNLALEIIIHELTHVDQLIDYKYIKFNNGYRNEIELQCVKQSCQWILDNIQYIRSLGLVVIPEVYQARLANLTNEVYTPKYPMAIAMGKLEYMLGRKFREFSNNNIEIEYIDRLKTHYAFMVCENRTYINSVNLNDLGERLLNDKQYTVEYLEYGNSKLVIKITQGA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.