NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103953_1011954

Scaffold Ga0103953_1011954


Overview

Basic Information
Taxon OID3300008687 Open in IMG/M
Scaffold IDGa0103953_1011954 Open in IMG/M
Source Dataset NameEukaryotic communities of Beech Litter from forest soil in Germany - LitterTranscript_20121
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterMYCOBT
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)606
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Forest Soil → Eukaryotic Communities Of Beech Litter From Forest Soil In Germany

Source Dataset Sampling Location
Location NameGermany: Rauhenebrach, Bavaria
CoordinatesLat. (o)49.926Long. (o)10.569Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058675Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0103953_10119541F058675N/AESYDESYKMFGEQIDKYEVKGPATELSKSFRNLDYFPRSWDMYHSTQKLDILYDPLWALHIVFPDIYPWSLIWRGHDEIRRTMDNAMYTFETKLQKSCEGNDAALNEGKSLADKLKQEVLEDYKFDGKLKTVAWYCEIMKAIVYPPFNAVVMPACKSIISPIAEAIPEPMQQFIDIEQLFDDIVNGIIDASIQTVVASGQKN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.