Scaffold Ga0103953_1007658

Overview

Basic Information

• Taxon OID: 3300008687
• Scaffold ID: Ga0103953_1007658
• Source Dataset Name: Eukaryotic communities of Beech Litter from forest soil in Germany - LitterTranscript_20121
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: MYCOBT
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 797
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Variosea → Cavosteliida → Cavosteliaceae → Planoprotostelium → Planoprotostelium fungivorum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Forest Soil → Eukaryotic Communities Of Beech Litter From Forest Soil In Germany

Source Dataset Sampling Location

• Location Name: Germany: Rauhenebrach, Bavaria
• Coordinates
  • Lat. (^o): 49.926
  • Long. (^o): 10.569

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014100	Metagenome / Metatranscriptome	265	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103953_10076581	F014100	N/A	MIENREYDKTRKHGERITDLLAQLERDAAAAKKKDGDLYQRKNKLIPKFQEMKKLINRALEALDSYRHKDFSEVLPSDLAQLSPPIVLDGISVHIVETFTSSEDDEDLLSSPHSDSSLEEEFEHILN*