NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115679_111331

Scaffold Ga0115679_111331


Overview

Basic Information
Taxon OID3300008635 Open in IMG/M
Scaffold IDGa0115679_111331 Open in IMG/M
Source Dataset NameHuman supragingival plaque microbial communities from NIH, USA - visit 1, subject 763901136 reassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2017
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameNational Institutes of Health, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041827Metagenome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0115679_1113311F041827N/AMKHFLSALALGCLLLSCNRDLENNETPAPAPQKEKLVLLKQLSEGSTVTFQYKNRNEIESVNIDGVGNSDIDYEYDTYGRIVKERRFHRRYDYGETNITYQYDGQGRLASSHAISTEFYPGTGLTPRCSVEKKHTYTYQGNKVTVKIEMGADTCSAIPETGKEKTITLLVENGRVTKTFDEQGNIKQTIEYYNTKNALRNIKGFPALVVEFYIRPLSYELPYYNHGIERIEDLRYIDNIKTRDFHDGDYWEYRYSYDKENTYNGDYPNGVGVHARVHNDPTYDEYLYEISADRSYIKEE*
Ga0115679_1113312F041827N/AALGCLLLSCNRDIENNENNETPAPPKEERLVLASLYEFGSNVRFQYKNGNEINRMAMDGPHGEASMDFEYDTYGRIVKERRFHHRSDYGETIITYQYDNQSKLLSSHAISTQYYPDTGYTPRCSVEKKHTYTYQGNKVTVKIEMGTDTCSAIPETGKEKTITLFVENGKVVKSLDENNQIIETIEYLNTKNTLRNMKGFPALVVEFYIRPFTYELPFYNGIEHIEDLRFIDNIKTRDFHNGSYWEYRYSYDKGKSHDNDYLEIEEVNIYEKSHNDPTHDNYLSSASPARFYTKEK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.