Scaffold Ga0110928_1168485

Overview

Basic Information

• Taxon OID: 3300008510
• Scaffold ID: Ga0110928_1168485
• Source Dataset Name: Microbial Communities in Water bodies, Singapore - Site RA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 622
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies → Microbial Communities In Water Bodies, Singapore

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.3
  • Long. (^o): 103.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000450	Metagenome / Metatranscriptome	1126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0110928_11684851	F000450	GAGG	VGDRANFGFVQPNGETIVLYGHWAGHQMLGRLADAVIAARPRWNDPAYATRIAISQLIKDDWNSETGWGLHVNEIADNEHKIAIVDWKQQTFSLHEEDSFSNTDNKIRGMKNEALFTMDLSTFCEKYALDGLLVN*