Basic Information | |
---|---|
Taxon OID | 3300008510 Open in IMG/M |
Scaffold ID | Ga0110928_1142410 Open in IMG/M |
Source Dataset Name | Microbial Communities in Water bodies, Singapore - Site RA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 708 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies → Microbial Communities In Water Bodies, Singapore |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.3 | Long. (o) | 103.8 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F064508 | Metagenome / Metatranscriptome | 128 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0110928_11424102 | F064508 | AGG | MSKLKEWFVAKYLQIEAQAIKSIDTANFYSNLFTERQKFYMIATFMALLAMTGAYGAVQFIGLVYIMSKLTPEDKDEN* |
⦗Top⦘ |