Scaffold Ga0114883_1021039

Overview

Basic Information

• Taxon OID: 3300008479
• Scaffold ID: Ga0114883_1021039
• Source Dataset Name: Human stool microbial communities from NIH, USA - visit 2, subject 763577454 reassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1230
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: National Institutes of Health, USA
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067720	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114883_10210394	F067720	AGGAGG	MASTTYRHIGDLTDMFAVQEQFRDITKMVCARLRGLTKTYHFAVIGNMVRNAGQLPQPFWLGVAFGGGARG