Scaffold Ga0115371_10887714

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115371_10887714

Scaffold Ga0115371_10887714

Overview

Basic Information
Taxon OID	3300008470 Open in IMG/M
Scaffold ID	Ga0115371_10887714 Open in IMG/M
Source Dataset Name	Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	799
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Sediment Core Microbial Communities From Adelie Basin, Antarctica

Source Dataset Sampling Location
Location Name	Adelie Basin, Antarctica
Coordinates	Lat. (^o)	-66.314	Long. (^o)	140.425	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016879	Metagenome	244	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115371_108877142	F016879	GGAG	MSVIKQSFFEASFQTKEEFDNAELAAKSDVSDNADLTVTEIKLEKSVIKTNKDKEQTNESEQHSKIAPEAK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.