Basic Information | |
---|---|
Taxon OID | 3300008470 Open in IMG/M |
Scaffold ID | Ga0115371_10370804 Open in IMG/M |
Source Dataset Name | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1858 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (16.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Sediment Core Microbial Communities From Adelie Basin, Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Adelie Basin, Antarctica | |||||||
Coordinates | Lat. (o) | -66.314 | Long. (o) | 140.425 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029569 | Metagenome / Metatranscriptome | 188 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115371_103708044 | F029569 | N/A | MKISCFILLLILSSCVSSEENVEEIKPFDSNTDSLFKSADDLVKLIMNNREQKVLLEQDLWRKKRDIKNITKIYTDSIWNLSNMYELNTLKIDKDSVVYNYKIILREIIDTVRLTVTDTVCDVCLTKQNKKDNRWYIKTFKWIKKTI* |
⦗Top⦘ |