| Basic Information | |
|---|---|
| Taxon OID | 3300008470 Open in IMG/M |
| Scaffold ID | Ga0115371_10205855 Open in IMG/M |
| Source Dataset Name | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 824 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Sediment Core Microbial Communities From Adelie Basin, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Adelie Basin, Antarctica | |||||||
| Coordinates | Lat. (o) | -66.314 | Long. (o) | 140.425 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004479 | Metagenome / Metatranscriptome | 436 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115371_102058551 | F004479 | AGGA | MHNNKILVGNSGDKVFLQGNKVIKEAGHYPEKFKQQMDFLMSCDHPNFIDVKPLSETSYEMKRFPTWYDKILTQPLLTSFDQLESLISIVGKFDSIGSNVKTESYLEKLQLRTGYTYEGKFDATSSWGFVHGDLTVSNILHDKDFLFIDPRGTEEQDYYDYGKLMQSFIMEYESHIYNNPSAKYSNFCRGAEQIMYEWCDEYQLKFFLAVHLLGAVPFFELNERYE |
| ⦗Top⦘ |